General Information

  • ID:  hor001932
  • Uniprot ID:  Q9PUR0
  • Protein name:  Glucagon-2
  • Gene name:  gcg2
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSQGSFTSDYSKHLDVKQAKDFVTWLLNT
  • Length:  29(44-72)
  • Propeptide:  MSNASGTLLSYMFMMLLGLTLASLVPHETDDGDLNAEISLANRHSQGSFTSDYSKHLDVKQAKDFVTWLLNTKRRGVDAQAGANLEKRHSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PUR0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001932_AF2.pdbhor001932_ESM.pdb

Physical Information

Mass: 385331 Formula: C151H226N40O47
Absent amino acids: CEIMPR Common amino acids: S
pI: 7.7 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -68.28 Boman Index: -5742
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 63.79
Instability Index: 1408.62 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  NA
  • Title:  NA