HORDB

ID: hor001932
Uniprot ID: Q9PUR0
Protein name: Glucagon-2
Gene name: gcg2
Organism: Petromyzon marinus (Sea lamprey)
Family: Glucagon family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region

Sequence: HSQGSFTSDYSKHLDVKQAKDFVTWLLNT
Length: 29
Propeptide: MSNASGTLLSYMFMMLLGLTLASLVPHETDDGDLNAEISLANRHSQGSFTSDYSKHLDVKQAKDFVTWLLNTKRRGVDAQAGANLEKRHSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001932_AF2.pdb

hor001932_ESM.pdb

Mass:	385331	Formula:	C151H226N40O47
Absent amino acids:	CEIMPR	Common amino acids:	S
pI:	7.7	Basic residues:	5
Polar residues:	10	Hydrophobic residues:	9
Hydrophobicity:	-68.28	Boman Index:	-5742
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.79
Instability Index:	1408.62	Extinction Coefficient cystines:	6990
Absorbance 280nm:	249.64